SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG22945_internal:A_TrvaFAMAMG_TR19233c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
slit,_partial_[Bombyx_mori]
Ontology
GO:0001764 P neuron migration
GO:0003151 P outflow tract morphogenesis
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0007427 P epithelial cell migration, open tracheal system
GO:0007432 P salivary gland boundary specification
GO:0007502 P digestive tract mesoderm development
GO:0007509 P mesoderm migration involved in gastrulation
GO:0008078 P mesodermal cell migration
GO:0008201 F heparin binding
GO:0008347 P glial cell migration
GO:0008406 P gonad development
GO:0010632 P regulation of epithelial cell migration
GO:0016199 P axon midline choice point recognition
GO:0022409 P positive regulation of cell-cell adhesion
GO:0030154 P cell differentiation
GO:0030182 P neuron differentiation
GO:0031012 C extracellular matrix
GO:0035050 P embryonic heart tube development
GO:0035385 P Roundabout signaling pathway
GO:0046331 P lateral inhibition
GO:0048495 F Roundabout binding
GO:0048813 P dendrite morphogenesis
GO:0048846 P axon extension involved in axon guidance
GO:0050770 P regulation of axonogenesis
GO:0050929 P induction of negative chemotaxis
GO:0071666 C Slit-Robo signaling complex
GO:2000274 P regulation of epithelial cell migration, open tracheal system
RNA-seq EntryA_TrvaFAMAMG_TR19233c0_g2_i1
Sequence
(Amino Acid)
AFDHLTMLSTLELSSNPLSCTCHLSWLSQWLRSRRLSSSATCGHPPTLQDANIHHLEPAD
FKCTPEDKGCLSPEYCPSPCTCTGTVVRCSRAKMTSLPANIPKQTTELYLESNELTSIMP
DQIRHLTQLTRLDLSNNKISVLGNNTFDGLTKLSTLIVSYNRLRCVQRDALKGLSQLRVL
SLHGNNISLLADGVFRDLESISHVALGSNPLYCDCHTRWLSEWVQSAGEFVEACLSYEEV
QHT
(80 a.a.)

- SilkBase 1999-2023 -