SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG22831_internal:A_TrvaFAMAMG_TR19171c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		nicotinic_acetylcholine_receptor_subunit_alpha_6_transcript_variant_1_[Bombyx_mori]
Ontology
GO:0000187 P obsolete activation of MAPK activity
GO:0001540 F amyloid-beta binding
GO:0001666 P response to hypoxia
GO:0001988 P positive regulation of heart rate involved in baroreceptor response to decreased systemic arterial blood pressure
GO:0004889 F acetylcholine-gated cation-selective channel activity
GO:0005216 F ion channel activity
GO:0005230 F extracellular ligand-gated ion channel activity
GO:0005886 C plasma membrane
GO:0005892 C acetylcholine-gated channel complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0006897 P endocytosis
GO:0007165 P signal transduction
GO:0007271 P synaptic transmission, cholinergic
GO:0007613 P memory
GO:0008284 P positive regulation of cell population proliferation
GO:0008306 P associative learning
GO:0009897 C external side of plasma membrane
GO:0014061 P regulation of norepinephrine secretion
GO:0015464 F acetylcholine receptor activity
GO:0015643 F toxic substance binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0017081 F chloride channel regulator activity
GO:0030054 C cell junction
GO:0030317 P flagellated sperm motility
GO:0030673 C axolemma
GO:0032094 P response to food
GO:0032225 P regulation of synaptic transmission, dopaminergic
GO:0032691 P negative regulation of interleukin-1 beta production
GO:0032715 P negative regulation of interleukin-6 production
GO:0032720 P negative regulation of tumor necrosis factor production
GO:0034220 P ion transmembrane transport
GO:0035094 P response to nicotine
GO:0035095 P behavioral response to nicotine
GO:0042110 P T cell activation
GO:0042113 P B cell activation
GO:0042166 F acetylcholine binding
GO:0042391 P regulation of membrane potential
GO:0042698 P ovulation cycle
GO:0042803 F protein homodimerization activity
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045471 P response to ethanol
GO:0045766 P positive regulation of angiogenesis
GO:0048149 P behavioral response to ethanol
GO:0050727 P regulation of inflammatory response
GO:0050728 P negative regulation of inflammatory response
GO:0050890 P cognition
GO:0060112 P generation of ovulation cycle rhythm
GO:0098655 P cation transmembrane transport
GO:0099565 P chemical synaptic transmission, postsynaptic
RNA-seq EntryA_TrvaFAMAMG_TR19171c1_g1_i1
Sequence
(Amino Acid)
SYNTLERPVANESEPLEVRFGLTLQQIIDVDEKNQILTTNVWLNLEWNDYNLRWNESEYG
GVKDLRITPNKLWKPDVLMYNSADEGFDGTYQTNVVVRSGGSCLYVPPGIFKSTCKMDIA
WF
(39 a.a.)

- SilkBase 1999-2023 -