SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG22689_5prime_partial:A_TrvaFAMAMG_TR18794c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_ras-related_protein_Rab-27A_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001750 C photoreceptor outer segment
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005770 C late endosome
GO:0005794 C Golgi apparatus
GO:0006605 P protein targeting
GO:0006886 P intracellular protein transport
GO:0006887 P exocytosis
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007596 P blood coagulation
GO:0008152 P metabolic process
GO:0010628 P positive regulation of gene expression
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0016324 C apical plasma membrane
GO:0019003 F GDP binding
GO:0019882 P antigen processing and presentation
GO:0019904 F protein domain specific binding
GO:0030141 C secretory granule
GO:0030318 P melanocyte differentiation
GO:0030425 C dendrite
GO:0030667 C secretory granule membrane
GO:0031489 F myosin V binding
GO:0032400 P melanosome localization
GO:0032402 P melanosome transport
GO:0032585 C multivesicular body membrane
GO:0033093 C Weibel-Palade body
GO:0036257 P multivesicular body organization
GO:0042470 C melanosome
GO:0043316 P cytotoxic T cell degranulation
GO:0043320 P natural killer cell degranulation
GO:0043473 P pigmentation
GO:0045921 P positive regulation of exocytosis
GO:0050766 P positive regulation of phagocytosis
GO:0051875 P pigment granule localization
GO:0051904 P pigment granule transport
GO:0070062 C extracellular exosome
GO:0070382 C exocytic vesicle
GO:0071985 P multivesicular body sorting pathway
GO:0097278 P complement-dependent cytotoxicity
GO:1903307 P positive regulation of regulated secretory pathway
GO:1903428 P positive regulation of reactive oxygen species biosynthetic process
GO:1903435 P positive regulation of constitutive secretory pathway
GO:1990182 P exosomal secretion
RNA-seq EntryA_TrvaFAMAMG_TR18794c0_g2_i1
Sequence
(Amino Acid)
QERFRSLTTAFYRDAMGFLLLFDLTNEASFLEVRNWIEQLKTHSLSDDPDIVLCGHKCDL
QEKRLVNQNRAREFAKNYNLVYLETSAKTGQNIDRAIDILLDRVMYRMEHSVEYAMLCAS
GRRRQSLQKLQARQERKLCTC
*(46 a.a.)

- SilkBase 1999-2023 -