| Name | O_TrvaFAMAMG22510_5prime_partial:A_TrvaFAMAMG_TR18733c0_g2_i2 |
| Scaffold_id | |
NCBI non-redundant (nr) | PREDICTED:_sorting_nexin-27_[Amyelois_transitella] |
| Ontology |
| GO:0001772 |
C |
immunological synapse |
| GO:0005515 |
F |
protein binding |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0005768 |
C |
endosome |
| GO:0005769 |
C |
early endosome |
| GO:0005829 |
C |
cytosol |
| GO:0006810 |
P |
transport |
| GO:0006886 |
P |
intracellular protein transport |
| GO:0007165 |
P |
signal transduction |
| GO:0008289 |
F |
lipid binding |
| GO:0008333 |
P |
endosome to lysosome transport |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0016197 |
P |
endosomal transport |
| GO:0030904 |
C |
retromer complex |
| GO:0031901 |
C |
early endosome membrane |
| GO:0032266 |
F |
phosphatidylinositol-3-phosphate binding |
| GO:0035091 |
F |
phosphatidylinositol binding |
| GO:0042493 |
P |
response to xenobiotic stimulus |
| GO:0071203 |
C |
WASH complex |
| GO:1990126 |
P |
endocytic recycling |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR18733c0_g2_i2 |
Sequence (Amino Acid) | SRRYREFAALHQVLKKEFIGFNFPRLPGKWPFNLSEQHLDSRRRGLEQYLEKVCAVRVIA
ESEAVQEFLSDGDDSCGATPVELKVLLPDRDVLTVAVLRSTHADHVYAAVCDKIQLAKHL
RKYFYLFEIVEYNFGELICTGARSCAHIYTMIFPCIQGDFLVRVQIEGRGS
*(56 a.a.) |