SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG22233_complete:A_TrvaFAMAMG_TR18621c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		MyD88_[Antheraea_pernyi]
Ontology
GO:0002224 P toll-like receptor signaling pathway
GO:0002376 P immune system process
GO:0002755 P MyD88-dependent toll-like receptor signaling pathway
GO:0005123 F death receptor binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006954 P inflammatory response
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0010008 C endosome membrane
GO:0032481 P positive regulation of type I interferon production
GO:0032740 P positive regulation of interleukin-17 production
GO:0032747 P positive regulation of interleukin-23 production
GO:0032755 P positive regulation of interleukin-6 production
GO:0034162 P toll-like receptor 9 signaling pathway
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045087 P innate immune response
GO:0050727 P regulation of inflammatory response
GO:0050830 P defense response to Gram-positive bacterium
GO:0070555 P response to interleukin-1
GO:0070935 P 3'-UTR-mediated mRNA stabilization
GO:0070976 F TIR domain binding
GO:0071260 P cellular response to mechanical stimulus
RNA-seq EntryA_TrvaFAMAMG_TR18621c0_g2_i1
Sequence
(Amino Acid)
MFQLCTKDTHAEFLIGHSTEYAPIAELISKRCRYIVLVFSPAFLKSSANAFYRDYAQAVS
IESRNRVIINKLIPIMYKECELPLHLKYYYCLRYSNSNSTTFNFWDKLKHSLRQHRVGPS
IQEASSHQSGLNIVELSDTTTTQIDRISLNGQDSISAKSESSLISIGQNSDVVKTKKKTL
GQRFRNVLQRKKLKKEKIAVPLSN
*(67 a.a.)

- SilkBase 1999-2023 -