SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG22232_complete:A_TrvaFAMAMG_TR18621c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		MyD88_[Antheraea_pernyi]
Ontology
GO:0002238 P response to molecule of fungal origin
GO:0002376 P immune system process
GO:0002755 P MyD88-dependent toll-like receptor signaling pathway
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006954 P inflammatory response
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0009615 P response to virus
GO:0009682 P induced systemic resistance
GO:0010468 P regulation of gene expression
GO:0016064 P immunoglobulin mediated immune response
GO:0031663 P lipopolysaccharide-mediated signaling pathway
GO:0032494 P response to peptidoglycan
GO:0032496 P response to lipopolysaccharide
GO:0032675 P regulation of interleukin-6 production
GO:0032680 P regulation of tumor necrosis factor production
GO:0032740 P positive regulation of interleukin-17 production
GO:0032747 P positive regulation of interleukin-23 production
GO:0032755 P positive regulation of interleukin-6 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0042127 P regulation of cell population proliferation
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0044130 P obsolete negative regulation of growth of symbiont in host
GO:0045080 P positive regulation of chemokine production
GO:0045087 P innate immune response
GO:0045351 P type I interferon production
GO:0046330 P positive regulation of JNK cascade
GO:0050671 P positive regulation of lymphocyte proliferation
GO:0050727 P regulation of inflammatory response
GO:0050830 P defense response to Gram-positive bacterium
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0070976 F TIR domain binding
GO:0090557 P establishment of endothelial intestinal barrier
GO:1902622 P regulation of neutrophil migration
GO:2000338 P regulation of chemokine (C-X-C motif) ligand 1 production
GO:2000341 P regulation of chemokine (C-X-C motif) ligand 2 production
RNA-seq EntryA_TrvaFAMAMG_TR18621c0_g1_i1
Sequence
(Amino Acid)
MRLKMASDSDIHSMPLSMIPYKTRQMLSCLLNSKKIIPSDGPDKLPRDWRGLASLVGIPS
QEAAFVQQCSNKTDKVLDIWQTKDSPTVGKLLEYLQRLDRFDVHDDVLHDLREIARKDKV
IDIGRQCEYEKNQIAVKNTQITINGDPYVHNEENVPQYDAFILYADEDQDFVNEIIDKLG
DMFQLCTKDTHAEFLIGHSTEYAPIAELISKRCRYIVLVFSPAFLKSSANAFYRDYAQAV
SIESRNRVIINKLIPIMYKECELPLHLKYYYCLRYSNSNSTTFNFWDKLKHSLRQHRVGP
SIQEASSHQSGLNIVELSDTTTTQIDRISLNGQDSISAKSESSLISIGQNSDVVKTKKKT
LGQRFRNVLQRKKLKKEKIAVPLSN
*(127 a.a.)

- SilkBase 1999-2023 -