SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG22128_complete:A_TrvaFAMAMG_TR18447c0_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
squid_protein_homologue_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000184 P nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0000398 P mRNA splicing, via spliceosome
GO:0000785 C chromatin
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0003730 F mRNA 3'-UTR binding
GO:0005634 C nucleus
GO:0005703 C polytene chromosome puff
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006405 P RNA export from nucleus
GO:0006406 P mRNA export from nucleus
GO:0007293 P germarium-derived egg chamber formation
GO:0007297 P ovarian follicle cell migration
GO:0007314 P oocyte anterior/posterior axis specification
GO:0008069 P dorsal/ventral axis specification, ovarian follicular epithelium
GO:0008298 P intracellular mRNA localization
GO:0009953 P dorsal/ventral pattern formation
GO:0016325 P oocyte microtubule cytoskeleton organization
GO:0017148 P negative regulation of translation
GO:0019094 P pole plasm mRNA localization
GO:0030529 C ribonucleoprotein complex
GO:0030720 P oocyte localization involved in germarium-derived egg chamber formation
GO:0033119 P negative regulation of RNA splicing
GO:0035062 C omega speckle
GO:0045451 P pole plasm oskar mRNA localization
GO:0048477 P oogenesis
GO:0071011 C precatalytic spliceosome
GO:0071013 C catalytic step 2 spliceosome
RNA-seq EntryA_TrvaFAMAMG_TR18447c0_g1_i2
Sequence
(Amino Acid)
MAFGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK
NQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGLGARGGRGGRGAR
GGRGGRGGYGGQPWGNQGYGGYGYGQGGYGGGYDSYGYGGYGYDGYGGYGGYDYSGYPNY
GKRGKQY
*(61 a.a.)

- SilkBase 1999-2023 -