SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG21961_complete:A_TrvaFAMAMG_TR18196c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_suppressor_of_cytokine_signaling_7-like_isoform_X2_[Papilio_xuthus]
Ontology
GO:0004860 F protein kinase inhibitor activity
GO:0005154 F epidermal growth factor receptor binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0006469 P negative regulation of protein kinase activity
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007175 P negative regulation of epidermal growth factor-activated receptor activity
GO:0007259 P receptor signaling pathway via JAK-STAT
GO:0009968 P negative regulation of signal transduction
GO:0016049 P cell growth
GO:0016567 P protein ubiquitination
GO:0019210 F kinase inhibitor activity
GO:0019221 P cytokine-mediated signaling pathway
GO:0030971 F receptor tyrosine kinase binding
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032715 P negative regulation of interleukin-6 production
GO:0035556 P intracellular signal transduction
GO:0040008 P regulation of growth
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0045627 P positive regulation of T-helper 1 cell differentiation
GO:0045629 P negative regulation of T-helper 2 cell differentiation
GO:0046426 P negative regulation of receptor signaling pathway via JAK-STAT
GO:0050728 P negative regulation of inflammatory response
GO:0071638 P negative regulation of monocyte chemotactic protein-1 production
RNA-seq EntryA_TrvaFAMAMG_TR18196c1_g1_i1
Sequence
(Amino Acid)
MGQQTSRKSECTCGCGAWERRRYAESPSSVQRYVSAVTDRWSGRECACRRRRWRRPACVC
TAYRRVGDDRLAAVLTLGARDLRRELDAIVLNTEGDSSRDSGEATAELYVLSVAPRTSET
ESPIQDGRRDETTQTNDSSIHLHPHFQVVCGSELRALLFRTPPLHPPPATKVHTQVDYIH
CLVPDLQEITACSYYWGKMDRYEAERLLDNKPEGTFLLRDSAQEEHLFSVSFRKYGRSLH
ARIEHYRHRFSFDSHDPAVFAANTVTGLIEHYKDPACVMFFEPMLTAPLVRTTPFPLQQL
ARAVIVSHTTYDGVEQLPLPVRLRHYLKEYHYRQRVRVRRLEHDMYQDTAQ
*(116 a.a.)

- SilkBase 1999-2023 -