| Name | O_TrvaFAMAMG21780_internal:A_TrvaFAMAMG_TR17739c0_g1_i1 |
| Scaffold_id | |
NCBI non-redundant (nr) | chromatin-associated_protein_[Enterocytozoon_bieneusi_H348] |
| Ontology |
| GO:0000400 |
F |
four-way junction DNA binding |
| GO:0002376 |
P |
immune system process |
| GO:0003677 |
F |
DNA binding |
| GO:0003690 |
F |
double-stranded DNA binding |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005694 |
C |
chromosome |
| GO:0005737 |
C |
cytoplasm |
| GO:0006310 |
P |
DNA recombination |
| GO:0006351 |
P |
transcription, DNA-templated |
| GO:0006355 |
P |
regulation of transcription, DNA-templated |
| GO:0007275 |
P |
multicellular organism development |
| GO:0008301 |
F |
DNA binding, bending |
| GO:0032392 |
P |
DNA geometric change |
| GO:0044822 |
F |
RNA binding |
| GO:0045087 |
P |
innate immune response |
| GO:0045596 |
P |
negative regulation of cell differentiation |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR17739c0_g1_i1 |
Sequence (Amino Acid) | SSGFILFGNDMRANDESIKNLAVTQQAQTIAKLWKDLDDGAKSVYIQRAEELKTQYKQDI
EEYKKTDSYKEFQKVLKYSKSGKTKKKGSGKMSGYRLFVKENKDVIDQGLDEEAS
(37 a.a.) |