SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG21748_complete:A_TrvaFAMAMG_TR17730c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_eye-specific_diacylglycerol_kinase_isoform_X4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004143 F diacylglycerol kinase activity
GO:0005524 F ATP binding
GO:0005875 C microtubule associated complex
GO:0006654 P phosphatidic acid biosynthetic process
GO:0006661 P phosphatidylinositol biosynthetic process
GO:0007015 P actin filament organization
GO:0007205 P protein kinase C-activating G protein-coupled receptor signaling pathway
GO:0007601 P visual perception
GO:0007602 P phototransduction
GO:0007605 P sensory perception of sound
GO:0007608 P sensory perception of smell
GO:0016020 C membrane
GO:0016056 P rhodopsin mediated signaling pathway
GO:0016059 P deactivation of rhodopsin mediated signaling
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019992 F diacylglycerol binding
GO:0035556 P intracellular signal transduction
GO:0043052 P thermotaxis
GO:0045494 P photoreceptor cell maintenance
GO:0046834 P lipid phosphorylation
GO:0046872 F metal ion binding
GO:0050896 P response to stimulus
RNA-seq EntryA_TrvaFAMAMG_TR17730c1_g1_i1
Sequence
(Amino Acid)
MKELHAAGYSLLSIDASGQTALHIAARYGNKEIVKYLIACAPTAILNMRDNERGQTALHK
AAAHRRRAVCCMLVAGGASLTRADHAGLTPRHLALRADDHDLAAYLESKILLIS
*(37 a.a.)

- SilkBase 1999-2023 -