SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG21483_complete:A_TrvaFAMAMG_TR17703c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC101741920_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006461 P protein-containing complex assembly
GO:0007016 P obsolete cytoskeletal anchoring at plasma membrane
GO:0007399 P nervous system development
GO:0007616 P long-term memory
GO:0008022 F protein C-terminus binding
GO:0008306 P associative learning
GO:0008328 C ionotropic glutamate receptor complex
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0017124 F SH3 domain binding
GO:0017146 C NMDA selective glutamate receptor complex
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030159 F signaling receptor complex adaptor activity
GO:0030160 F synaptic receptor adaptor activity
GO:0030425 C dendrite
GO:0030534 P adult behavior
GO:0031877 F somatostatin receptor binding
GO:0032232 P negative regulation of actin filament bundle assembly
GO:0032403 F protein-containing complex binding
GO:0035176 P social behavior
GO:0035255 F ionotropic glutamate receptor binding
GO:0035418 P protein localization to synapse
GO:0042048 P olfactory behavior
GO:0042802 F identical protein binding
GO:0043005 C neuron projection
GO:0043197 C dendritic spine
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046959 P habituation
GO:0050885 P neuromuscular process controlling balance
GO:0050894 P determination of affect
GO:0060013 P righting reflex
GO:0060074 P synapse maturation
GO:0060076 C excitatory synapse
GO:0060997 P dendritic spine morphogenesis
GO:0060999 P positive regulation of dendritic spine development
GO:0071532 F ankyrin repeat binding
GO:0071625 P vocalization behavior
GO:0097110 F scaffold protein binding
GO:0097481 C postsynaptic density
GO:2000311 P regulation of AMPA receptor activity
GO:2000463 P positive regulation of excitatory postsynaptic potential
RNA-seq EntryA_TrvaFAMAMG_TR17703c1_g1_i1
Sequence
(Amino Acid)
MATDNTETSTNDGTKENHNDKGVSNGPSTITASQAQAVAAALQREADEHLFLRYLELDPP
DDPSAPRRPQRNGRTPFTTTRKLVRGTAAGFGFTVVWTRPPRVERVAQGGSAERAGLRAG
DYIVFVGTKNVVTASEEEVRNLVKSAGQTLQLETFRRVPPNGVGVRPRLAQVSIPPPEST
PPPAPRSPRSNALASPATAARPPTACSSTSQSLDRRKLHLPQVTFSKEVGNGIIV
*(77 a.a.)

- SilkBase 1999-2023 -