SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG211_internal:A_TrvaFAMAMG_TR94c2_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Adenylate_cyclase_type_3_[Papilio_machaon]
Ontology
GO:0000166 F nucleotide binding
GO:0004016 F adenylate cyclase activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0006171 P cAMP biosynthetic process
GO:0007143 P female meiotic nuclear division
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 P activation of adenylate cyclase activity
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007338 P single fertilization
GO:0007340 P acrosome reaction
GO:0007608 P sensory perception of smell
GO:0008294 F calcium- and calmodulin-responsive adenylate cyclase activity
GO:0008355 P olfactory learning
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0019933 P cAMP-mediated signaling
GO:0030317 P flagellated sperm motility
GO:0035556 P intracellular signal transduction
GO:0042995 C cell projection
GO:0045121 C membrane raft
GO:0046872 F metal ion binding
GO:0050896 P response to stimulus
GO:1904322 P cellular response to forskolin
RNA-seq EntryA_TrvaFAMAMG_TR94c2_g1_i1
Sequence
(Amino Acid)
LIFYSTTSLSIYLTVQYYNALTAESRLPEDFDLQVYANGTLLLGVTFLGCTAYIVTEKNQ
RSSFKETKRSLRDKLTIEQQSKEQERLLLSVLPEHVAVQMRKELGLIDTQFKKIYMSRHE
NVSILYADIVGFTAISSTYSAQDLVAILNELFARFDRLAEKYQQLRIKILGDCYYCISGA
PVERPDHAVLCVHMGLSMVKAIKYVQQITSSPVDMRVGIHTGAVLAGVLGQRQWQFDVYS
RDVELANKMESSGMAGRVH
(85 a.a.)

- SilkBase 1999-2023 -