SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG2060_complete:A_TrvaFAMAMG_TR3142c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_cell_division_cycle_5-like_protein_[Bombyx_mori]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000278 P mitotic cell cycle
GO:0000974 C Prp19 complex
GO:0001222 F transcription corepressor binding
GO:0003677 F DNA binding
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005662 C DNA replication factor A complex
GO:0005681 C spliceosomal complex
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0008157 F protein phosphatase 1 binding
GO:0008380 P RNA splicing
GO:0016020 C membrane
GO:0016607 C nuclear speck
GO:0019901 F protein kinase binding
GO:0032993 C protein-DNA complex
GO:0043522 F leucine zipper domain binding
GO:0044344 P cellular response to fibroblast growth factor stimulus
GO:0044822 F RNA binding
GO:0048471 C perinuclear region of cytoplasm
GO:0071013 C catalytic step 2 spliceosome
GO:0071352 P cellular response to interleukin-2
GO:0071987 F WD40-repeat domain binding
GO:0072422 P DNA damage checkpoint signaling
GO:1904568 P cellular response to wortmannin
GO:1990090 P cellular response to nerve growth factor stimulus
GO:1990646 P cellular response to prolactin
RNA-seq EntryA_TrvaFAMAMG_TR3142c0_g2_i1
Sequence
(Amino Acid)
MAKEAKKCSKMEKKLRVLTGGYQSRAAALIKQFQELQDQIEQANLELSTFKFLAEQEKAA
IPRRIESLTEDVNRQTEREKQLQKRYAELQAEVENMQKGKGKNIDKTVHAID
*(36 a.a.)

- SilkBase 1999-2023 -