SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG19760_complete:A_TrvaFAMAMG_TR16964c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
Ionotropic_receptor,_partial_[Operophtera_brumata]
Ontology
GO:0004872 F signaling receptor activity
GO:0004970 F ionotropic glutamate receptor activity
GO:0005216 F ion channel activity
GO:0005234 F extracellularly glutamate-gated ion channel activity
GO:0005515 F protein binding
GO:0005783 C endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0006621 P protein retention in ER lumen
GO:0006810 P transport
GO:0006811 P ion transport
GO:0007268 P chemical synaptic transmission
GO:0008066 F glutamate receptor activity
GO:0008328 C ionotropic glutamate receptor complex
GO:0014069 C postsynaptic density
GO:0015277 F kainate selective glutamate receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017124 F SH3 domain binding
GO:0030054 C cell junction
GO:0030165 F PDZ domain binding
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031630 P regulation of synaptic vesicle fusion to presynaptic active zone membrane
GO:0032983 C kainate selective glutamate receptor complex
GO:0034220 P ion transmembrane transport
GO:0035235 P ionotropic glutamate receptor signaling pathway
GO:0035249 P synaptic transmission, glutamatergic
GO:0042391 P regulation of membrane potential
GO:0042734 C presynaptic membrane
GO:0042802 F identical protein binding
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043113 P receptor clustering
GO:0043195 C terminal bouton
GO:0043204 C perikaryon
GO:0043525 P positive regulation of neuron apoptotic process
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0051649 P establishment of localization in cell
GO:0060079 P excitatory postsynaptic potential
GO:0071333 P cellular response to glucose stimulus
RNA-seq EntryA_TrvaFAMAMG_TR16964c0_g1_i1
Sequence
(Amino Acid)
MTEGYAGHRFIVAAANQPPFVFRRIKADLDGGNPRVVWDGIEIRLLQLLADRNNFSIEIV
EPQEPNLGSGDAVAKEIATGRADMGVAGMYLTIERARDMDVTFAHSQDCAVFITLMSTAL
PRYRAILGPFHWHVWVALTFTYLFGMFPLAFSDKHTLRHLINNSGEIENMFWYVFGTFTN
CFTFLGKNSWSKTNKITTRLLIGWYWIFTIIITSCYTGSIIAFVTLPVFPETVDTIEQLL
GGFYRVGTLDRGGWERWFFNSSDQKNQ
*(88 a.a.)

- SilkBase 1999-2023 -