SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG19591_internal:A_TrvaFAMAMG_TR16763c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_voltage-dependent_T-type_calcium_channel_subunit_alpha-1G-like_[Amyelois_transitella]
Ontology
GO:0001508 P action potential
GO:0002027 P regulation of heart rate
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005245 F voltage-gated calcium channel activity
GO:0005262 F calcium channel activity
GO:0005886 C plasma membrane
GO:0005891 C voltage-gated calcium channel complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0007268 P chemical synaptic transmission
GO:0008332 F low voltage-gated calcium channel activity
GO:0010045 P response to nickel cation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0034765 P regulation of ion transmembrane transport
GO:0042391 P regulation of membrane potential
GO:0045956 P positive regulation of calcium ion-dependent exocytosis
GO:0055085 P transmembrane transport
GO:0060371 P regulation of atrial cardiac muscle cell membrane depolarization
GO:0070509 P calcium ion import
GO:0070588 P calcium ion transmembrane transport
GO:0086010 P membrane depolarization during action potential
GO:0086015 P SA node cell action potential
GO:0086016 P AV node cell action potential
GO:0086018 P SA node cell to atrial cardiac muscle cell signaling
GO:0086027 P AV node cell to bundle of His cell signaling
GO:0086045 P membrane depolarization during AV node cell action potential
GO:0086046 P membrane depolarization during SA node cell action potential
GO:0086056 F voltage-gated calcium channel activity involved in AV node cell action potential
GO:0086059 F voltage-gated calcium channel activity involved SA node cell action potential
GO:0086091 P regulation of heart rate by cardiac conduction
GO:0097110 F scaffold protein binding
RNA-seq EntryA_TrvaFAMAMG_TR16763c0_g1_i1
Sequence
(Amino Acid)
IFLLTRFIHLYIQVLTQEDWNVVLFNGMEKTSHWAALYFVALMTFGNYVLFNLLVAILVE
GFSSERNERREREQRELAKSKLSSECYSENNELHYDESNSASHSSDSFSQNEIKNYWKSA
DDVRKAKDDVNGHKEKAMKKRKTKSSHHPTLCKDCAQSNKCNIQKESKMLASNAGVGEPA
VPMITHTAATPQDSPSTTLEPGASFRDFNMTLSLERSSMLSSLDSIDRTSCASIPGLLKP
PNSYTLTLHSVQAHLGAEKARLPPLTLAPPPLTLAPPPLRSSTPATPTTPKTIPSPILPE
KNLQ
(100 a.a.)

- SilkBase 1999-2023 -