SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG19315_5prime_partial:A_TrvaFAMAMG_TR16340c1_g2_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_B-box_type_zinc_finger_protein_ncl-1-like_[Plutella_xylostella]
Ontology
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0006417 P regulation of translation
GO:0006909 P phagocytosis
GO:0007400 P neuroblast fate determination
GO:0007402 P ganglion mother cell fate determination
GO:0007405 P neuroblast proliferation
GO:0007406 P negative regulation of neuroblast proliferation
GO:0007411 P axon guidance
GO:0007419 P ventral cord development
GO:0007420 P brain development
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0008356 P asymmetric cell division
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0009303 P rRNA transcription
GO:0017148 P negative regulation of translation
GO:0022008 P neurogenesis
GO:0030182 P neuron differentiation
GO:0030371 F translation repressor activity
GO:0035282 P segmentation
GO:0043025 C neuronal cell body
GO:0045179 C apical cortex
GO:0045180 C basal cortex
GO:0045182 F translation regulator activity
GO:0046872 F metal ion binding
GO:0048477 P oogenesis
GO:0050767 P regulation of neurogenesis
GO:0051726 P regulation of cell cycle
GO:0055060 P asymmetric neuroblast division resulting in ganglion mother cell formation
GO:1900242 P regulation of synaptic vesicle endocytosis
RNA-seq EntryA_TrvaFAMAMG_TR16340c1_g2_i2
Sequence
(Amino Acid)
AVDSVTPTVFILSEEGELMSWFDCSECMREPSDIAISGKEFYVCDFKGHCVVVFDEEGRF
LRRIGCENVTNFPNGIDVSDAGDVLIGDSHGNKFHVAVFSREGVLVTEFECPYVKVSRCC
GLKITSEGYIVTLAKNNHHVLVLNTLYIV
*(49 a.a.)

- SilkBase 1999-2023 -