SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG19132_3prime_partial:A_TrvaFAMAMG_TR16321c0_g1_i3
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC106129437_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000775 C chromosome, centromeric region
GO:0001741 C XY body
GO:0001934 P positive regulation of protein phosphorylation
GO:0002039 F p53 binding
GO:0003714 F transcription corepressor activity
GO:0005057 F obsolete signal transducer activity, downstream of receptor
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005874 C microtubule
GO:0005938 C cell cortex
GO:0006334 P nucleosome assembly
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006915 P apoptotic process
GO:0007257 P obsolete activation of JUN kinase activity
GO:0008134 F transcription factor binding
GO:0008625 P extrinsic apoptotic signaling pathway via death domain receptors
GO:0010038 P response to metal ion
GO:0010832 P negative regulation of myotube differentiation
GO:0016032 P viral process
GO:0016568 P chromatin organization
GO:0016605 C PML body
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0030295 F protein kinase activator activity
GO:0030521 P androgen receptor signaling pathway
GO:0030578 P PML body organization
GO:0031072 F heat shock protein binding
GO:0031396 P regulation of protein ubiquitination
GO:0031625 F ubiquitin protein ligase binding
GO:0033129 P positive regulation of histone phosphorylation
GO:0042393 F histone binding
GO:0042803 F protein homodimerization activity
GO:0043005 C neuron projection
GO:0043065 P positive regulation of apoptotic process
GO:0044297 C cell body
GO:0045860 P positive regulation of protein kinase activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0047485 F protein N-terminus binding
GO:0050681 F androgen receptor binding
GO:0070603 C SWI/SNF superfamily-type complex
GO:0071356 P cellular response to tumor necrosis factor
GO:0071454 P cellular response to anoxia
GO:1901216 P positive regulation of neuron death
RNA-seq EntryA_TrvaFAMAMG_TR16321c0_g1_i3
Sequence
(Amino Acid)
MASEDVIELGSSDDDVEPAPKRPKTKLNAMVHIPNNLTGITIKPAKACNSAVPPSLLGRP
ITITKVSKNSLINPVLTKLKKNGCAVQRHTSATKLSPKQIIKQPQKIKSIGTIQTAQSVN
ILNHSIRTNNVQQLNRIPVRAPINVQKVKSLIPSSITVKKTQMRKQAHPVHTNMTNVKRK
ERFKISCAKLSRAEVSTVELDDDDNTCVDPGPARQWYLRPEDTTQTEKNDTEEPSDMEKQ
NNAEPNPSEMVEITIQDSPIQSKKKAFEVGAEFAITIDDSPSKPPAESKSRTDSSDSENN
KQKKESHRKKKLEYPKEQKKRQSIEIEILPINANQNDNADERNTLNNDTKEQAPQNTDVI
EIEESPMKIPETEATTPKKKTSNATVLKNKPFNIQKEEVKQNGEFHPVYQEFIDLCFKLE
STEDMEKIIEKKIKSYYRQVPKDYTESEEFVDMVSGKIISMKASPEKMYLYIKDIVDELN
FKRKMLKSQGAATEETKSNEIDSFLYGENSELGPKRQRQIRKLEKTLKKLHRAIQKLEEQ
EVDFDDDDDSVYLLTERYGFFTSFILKSM
(188 a.a.)

- SilkBase 1999-2023 -