SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG19124_internal:A_TrvaFAMAMG_TR16319c14_g3_i5
Scaffold_id
NCBI non-redundant
(nr)		uridine_diphosphate_glucosyltransferase_[Bombyx_mori]
Ontology
GO:0004857 F enzyme inhibitor activity
GO:0005080 F protein kinase C binding
GO:0005496 F steroid binding
GO:0005504 F fatty acid binding
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0008144 F obsolete drug binding
GO:0008152 P metabolic process
GO:0009813 P flavonoid biosynthetic process
GO:0015020 F glucuronosyltransferase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0016758 F hexosyltransferase activity
GO:0019899 F enzyme binding
GO:0042803 F protein homodimerization activity
GO:0043086 P negative regulation of catalytic activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0046982 F protein heterodimerization activity
GO:0052696 P flavonoid glucuronidation
GO:0052697 P xenobiotic glucuronidation
GO:0070062 C extracellular exosome
RNA-seq EntryA_TrvaFAMAMG_TR16319c14_g3_i5
Sequence
(Amino Acid)
PLIGMPMLGDQWYNVELYMKYGIGLRLDMDELSEENLENYIQEVIENDSYRQNIARIRSQ
VYDQPQSSLERAVWWTEHVLRHGGGKHLRPAGANISWSQYLELP
(33 a.a.)

- SilkBase 1999-2023 -