| Name | O_TrvaFAMAMG1908_complete:A_TrvaFAMAMG_TR2998c0_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_lachesin-like_[Bombyx_mori] |
| Ontology |
| GO:0005515 |
F |
protein binding |
| GO:0005768 |
C |
endosome |
| GO:0005886 |
C |
plasma membrane |
| GO:0007155 |
P |
cell adhesion |
| GO:0007275 |
P |
multicellular organism development |
| GO:0007399 |
P |
nervous system development |
| GO:0009986 |
C |
cell surface |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0030154 |
P |
cell differentiation |
| GO:0030165 |
F |
PDZ domain binding |
| GO:0030424 |
C |
axon |
| GO:0030425 |
C |
dendrite |
| GO:0030426 |
C |
growth cone |
| GO:0042995 |
C |
cell projection |
| GO:0043025 |
C |
neuronal cell body |
| GO:0044295 |
C |
axonal growth cone |
| GO:0045121 |
C |
membrane raft |
| GO:0045773 |
P |
positive regulation of axon extension |
| GO:0071361 |
P |
cellular response to ethanol |
| GO:0071560 |
P |
cellular response to transforming growth factor beta stimulus |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR2998c0_g1_i1 |
Sequence
(Amino Acid) | MIGAYVGETIALQCKIEAYPTPSISWVHQDSSKLQNGTKYQASIKSKNYRHTAILKVNNV
SREDIGSYYCFAENQLGSSKDDVTLYTLATTTVSTSTTELTTIELLWTSTHYAELEASSD
DSQKYSNEDRYVVVLSQQQMQNLDLPPSS
*(49 a.a.) |
