SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG18931_complete:A_TrvaFAMAMG_TR16294c14_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_nephrin-like,_partial_[Bombyx_mori]
Ontology
GO:0001675 P acrosome assembly
GO:0002860 P positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
GO:0002891 P positive regulation of immunoglobulin mediated immune response
GO:0004872 F signaling receptor activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005911 C cell-cell junction
GO:0005915 C zonula adherens
GO:0005925 C focal adhesion
GO:0007010 P cytoskeleton organization
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007286 P spermatid development
GO:0007289 P spermatid nucleus differentiation
GO:0008037 P cell recognition
GO:0009566 P fertilization
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019064 P fusion of virus membrane with host plasma membrane
GO:0030382 P sperm mitochondrion organization
GO:0032990 P cell part morphogenesis
GO:0033005 P positive regulation of mast cell activation
GO:0042271 P susceptibility to natural killer cell mediated cytotoxicity
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0044406 P adhesion of symbiont to host
GO:0044782 P cilium organization
GO:0045954 P positive regulation of natural killer cell mediated cytotoxicity
GO:0046596 P regulation of viral entry into host cell
GO:0046814 P coreceptor-mediated virion attachment to host cell
GO:0050839 F cell adhesion molecule binding
GO:0051654 P establishment of mitochondrion localization
GO:0060370 P susceptibility to T cell mediated cytotoxicity
GO:0070062 C extracellular exosome
RNA-seq EntryA_TrvaFAMAMG_TR16294c14_g1_i1
Sequence
(Amino Acid)
MQRLPTMLSQARFIYFVLLSLLLQYCVKSQQEILIEESAAIESLHAPTGGSVELPCDVTP
TEPEDMMGLVIWYKQGHKTPIYSFDTREGVTSHWSDPSTLGVRATFRSDSRPAVLILTKL
RPEDSGQYRCRVDFIKSQTKNTRLNLTVLIPPERLIILNQEGNEISAGILGPYDEGTEVN
LTCIAVGGRPVARVSWWKSHALLANSEARATVSFRVQRSDYGTDVTCQAVTDPVIPPVSE
NISIDVNCKF
*(82 a.a.)

- SilkBase 1999-2023 -