SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG18842_complete:A_TrvaFAMAMG_TR16282c4_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_dual_specificity_protein_phosphatase_22_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000188 P obsolete inactivation of MAPK activity
GO:0002710 P negative regulation of T cell mediated immunity
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006470 P protein dephosphorylation
GO:0006915 P apoptotic process
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0008138 F protein tyrosine/serine/threonine phosphatase activity
GO:0008283 P cell population proliferation
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0042127 P regulation of cell population proliferation
GO:0046330 P positive regulation of JNK cascade
GO:0050860 P negative regulation of T cell receptor signaling pathway
GO:0050868 P negative regulation of T cell activation
RNA-seq EntryA_TrvaFAMAMG_TR16282c4_g1_i1
Sequence
(Amino Acid)
MGNGMNKVLPGLYVGNYRDSKDTVQLDKYKITHILSIHDAARRLHSDKHYLCIMASDSPD
QNLTQYFSLCNDFIHAARLRDGNVLIHCLAGMSRSVTVAVAYIMSVTTLTWREALKVVRA
GRAVANPNLGFQRQLQDFETYKLVEERRRLKERYPSLALTEKDLNECRVMLDSYQTMLSQ
KTICEGKCAMGRQCPTGKVFVERHLSDSHGHGRPQRLLAATPAQRL
*(74 a.a.)

- SilkBase 1999-2023 -