SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG18735_complete:A_TrvaFAMAMG_TR16277c0_g2_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_fibroblast_growth_factor_receptor_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001710 P mesodermal cell fate commitment
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005007 F fibroblast growth factor-activated receptor activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0006468 P protein phosphorylation
GO:0007275 P multicellular organism development
GO:0007280 P pole cell migration
GO:0007369 P gastrulation
GO:0007417 P central nervous system development
GO:0007419 P ventral cord development
GO:0007431 P salivary gland development
GO:0007492 P endoderm development
GO:0007493 P endodermal cell fate determination
GO:0007498 P mesoderm development
GO:0007500 P mesodermal cell fate determination
GO:0007506 P gonadal mesoderm development
GO:0007507 P heart development
GO:0007509 P mesoderm migration involved in gastrulation
GO:0007517 P muscle organ development
GO:0007522 P visceral muscle development
GO:0007523 P larval visceral muscle development
GO:0007525 P somatic muscle development
GO:0008078 P mesodermal cell migration
GO:0008284 P positive regulation of cell population proliferation
GO:0008347 P glial cell migration
GO:0008354 P germ cell migration
GO:0008360 P regulation of cell shape
GO:0008406 P gonad development
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0010001 P glial cell differentiation
GO:0010002 P cardioblast differentiation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019233 P sensory perception of pain
GO:0021782 P glial cell development
GO:0045089 P positive regulation of innate immune response
GO:0048542 P lymph gland development
GO:0048747 P muscle cell development
GO:0050829 P defense response to Gram-negative bacterium
GO:0061320 P pericardial nephrocyte differentiation
RNA-seq EntryA_TrvaFAMAMG_TR16277c0_g2_i2
Sequence
(Amino Acid)
MNLAAICFWRVTMLMLAATCAASARDIVLDDNYTVIEAVTNDRLRLVCGLKSKSQGQVVQ
WFKDGQALDGVSKRITQQRQWLRIKAFRAKDAGVYSCKTEEDKYKEMAVTIKHKVGNYQD
NLEEYQADVDVERPMPEILAQHQADTENSRSEENMTDPKRSKEYDPKDDDLDEKNEKDHP
VYGHVDETKTKYPPKFKHPSKMYSMEMKPAGSSIRFKCPAEGNPTPNITWYKNKSNPIQR
TYFQPTYAKWSINLDELTKTDNGNYTCVVCNELGCIEHTVVLRIQERLYAKPVLTQGAVN
QTRLVGETVKFSCEFLSDLHPFVYWMHIPTDQYTNADGDGTVIDSNDTRKFILNSDEVIN
ACVWVFACLL
*(122 a.a.)

- SilkBase 1999-2023 -