SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG18717_internal:A_TrvaFAMAMG_TR16274c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
Ribonuclease_3_[Papilio_machaon]
Ontology
GO:0001530 F lipopolysaccharide binding
GO:0003723 F RNA binding
GO:0003725 F double-stranded RNA binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0004521 F endoribonuclease activity
GO:0004525 F ribonuclease III activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006396 P RNA processing
GO:0010468 P regulation of gene expression
GO:0010586 P miRNA metabolic process
GO:0010628 P positive regulation of gene expression
GO:0016075 P rRNA catabolic process
GO:0016787 F hydrolase activity
GO:0030422 P production of siRNA involved in RNA interference
GO:0031047 P gene silencing by RNA
GO:0031053 P primary miRNA processing
GO:0031054 P pre-miRNA processing
GO:0042254 P ribosome biogenesis
GO:0042803 F protein homodimerization activity
GO:0044822 F RNA binding
GO:0046872 F metal ion binding
GO:0050829 P defense response to Gram-negative bacterium
GO:0050830 P defense response to Gram-positive bacterium
GO:0070877 C microprocessor complex
GO:0070878 F primary miRNA binding
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:0090501 P RNA phosphodiester bond hydrolysis
GO:0090502 P RNA phosphodiester bond hydrolysis, endonucleolytic
GO:2000628 P regulation of miRNA metabolic process
RNA-seq EntryA_TrvaFAMAMG_TR16274c0_g2_i1
Sequence
(Amino Acid)
PRFVRYLPEGGCEVLSMCEVLKYLIDESGLLIPPDKLKDVHAMDHYTWQKFVDRIKGMIV
TYPGKKPCSVRVDQLDRSPPTPPEGEESQPIEEYYPEIVHFGIRPPQLSYAGNPEYQKAW
RYYVKYRHLIANMSKTSYKERQKLAAKEAKLQEMRTQSKMKRDVTVAISSEGFHTTGLMC
DIVQHAMLIPVLVRHLRFHKSLDKLEEKINYVFKQRALLQTALTHPSYRENFGTNPDHAR
NSLTNCGIRQPEYGDRRIHYTRKKGKMIEGSL
(89 a.a.)

- SilkBase 1999-2023 -