SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG1863_complete:A_TrvaFAMAMG_TR2982c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_MICAL-like_protein_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0001725 C stress fiber
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005923 C bicellular tight junction
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0017137 F small GTPase binding
GO:0030041 P actin filament polymerization
GO:0030054 C cell junction
GO:0031005 F filamin binding
GO:0031175 P neuron projection development
GO:0031532 P actin cytoskeleton reorganization
GO:0032432 C actin filament bundle
GO:0032456 P endocytic recycling
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0042805 F actinin binding
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0046872 F metal ion binding
GO:0051015 F actin filament binding
GO:0055037 C recycling endosome
GO:0070830 P bicellular tight junction assembly
GO:1903955 P positive regulation of protein targeting to mitochondrion
RNA-seq EntryA_TrvaFAMAMG_TR2982c0_g1_i1
Sequence
(Amino Acid)
MYIRRQQRLEQEQADIEHEIRIIHSRPAVNRIDADKVREEELVTRLVEIVRLRDELVQQL
DAERRRERQEDLAIAASIATKRAQRQNDSNNSSIKSVEVVTPKKNKVKDKMKKQFKKAKH
TLISKKKEDSPEHKEEKERKKSK
*(47 a.a.)

- SilkBase 1999-2023 -