| Name | O_TrvaFAMAMG18363_5prime_partial:A_TrvaFAMAMG_TR16172c0_g1_i1 |
| Scaffold_id | |
NCBI non-redundant (nr) | PREDICTED:_E3_ubiquitin-protein_ligase_UBR3-like,_partial_[Papilio_machaon] |
| Ontology |
| GO:0000151 |
C |
ubiquitin ligase complex |
| GO:0001701 |
P |
in utero embryonic development |
| GO:0001967 |
P |
suckling behavior |
| GO:0004842 |
F |
ubiquitin-protein transferase activity |
| GO:0005737 |
C |
cytoplasm |
| GO:0006511 |
P |
ubiquitin-dependent protein catabolic process |
| GO:0007608 |
P |
sensory perception of smell |
| GO:0008270 |
F |
zinc ion binding |
| GO:0009790 |
P |
embryo development |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016567 |
P |
protein ubiquitination |
| GO:0016874 |
F |
ligase activity |
| GO:0042048 |
P |
olfactory behavior |
| GO:0046872 |
F |
metal ion binding |
| GO:0061630 |
F |
ubiquitin protein ligase activity |
| GO:0071596 |
P |
ubiquitin-dependent protein catabolic process via the N-end rule pathway |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR16172c0_g1_i1 |
Sequence (Amino Acid) | VLRALHVEWAPGALLALPHEYDRLFSVYHERACATCGAAPKEASLCLACGALVCLKAACC
RRHGTAEAVRHAAHCGAGTALFLVVTSTYIIVIRGRRACLWGSLYLDDYDEEDRDLKRGK
PLYLSKDRLELLQAQWLSHRFDHTKRTWVWHRDSL
*(51 a.a.) |