SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG18235_internal:A_TrvaFAMAMG_TR15851c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_protein_giant-lens_isoform_X1_[Bombyx_mori]
Ontology
GO:0001654 P eye development
GO:0005154 F epidermal growth factor receptor binding
GO:0005576 C extracellular region
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0007455 P eye-antennal disc morphogenesis
GO:0007472 P wing disc morphogenesis
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007482 P haltere development
GO:0007601 P visual perception
GO:0009996 P negative regulation of cell fate specification
GO:0016318 P ommatidial rotation
GO:0030707 P ovarian follicle cell development
GO:0035215 P genital disc development
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0042067 P establishment of ommatidial planar polarity
GO:0043065 P positive regulation of apoptotic process
GO:0045596 P negative regulation of cell differentiation
GO:0046331 P lateral inhibition
GO:0048019 F receptor antagonist activity
GO:0050768 P negative regulation of neurogenesis
GO:0050896 P response to stimulus
GO:0060233 P oenocyte delamination
GO:1900116 P extracellular negative regulation of signal transduction
GO:2000737 P negative regulation of stem cell differentiation
RNA-seq EntryA_TrvaFAMAMG_TR15851c0_g1_i1
Sequence
(Amino Acid)
PSANMQVLASLILAYAFCGVRGVIRTPLEAFRPSAEIHIRRPDKLPLLPHRRTTIPPKSG
IKILYQTGVSEEDLPDCRPRQVCSKVDLYDASQPWIEKKCRCLGHRPCSSELSIDDNHTL
ADKTTLYKTCEPVKRLPKCRY
(46 a.a.)

- SilkBase 1999-2023 -