SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG18167_complete:A_TrvaFAMAMG_TR15630c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_E3_SUMO-protein_ligase_NSE2-like_[Plutella_xylostella]
Ontology
GO:0000722 P telomere maintenance via recombination
GO:0000724 P double-strand break repair via homologous recombination
GO:0000781 C chromosome, telomeric region
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0006281 P DNA repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008270 F zinc ion binding
GO:0016605 C PML body
GO:0016874 F ligase activity
GO:0016925 P protein sumoylation
GO:0019789 F SUMO transferase activity
GO:0030915 C Smc5-Smc6 complex
GO:0034184 P positive regulation of maintenance of mitotic sister chromatid cohesion
GO:0045842 P positive regulation of mitotic metaphase/anaphase transition
GO:0046872 F metal ion binding
GO:0051301 P cell division
GO:0090398 P cellular senescence
RNA-seq EntryA_TrvaFAMAMG_TR15630c0_g1_i1
Sequence
(Amino Acid)
MADIDLRELRKQCITNLHSCAENVAKYLLGDKKDNYEKLKVYMEKYCMLEVQQEVAEQAL
EAAKEETDASNIDSIDHRFQDGLTTLSQRRVNPNSHRYMQELKTKYECGLRSIAPSQTPS
IVSQNNSEELTIVNTQDQYLDPLTKKPISDPVKNTMCGHVYERSTILDLIRRKLNRVRCP
VVGCANPQRLQESHLLDDEELRFRALITQNSTMI
*(70 a.a.)

- SilkBase 1999-2023 -