SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG18034_complete:A_TrvaFAMAMG_TR15408c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
E2F_family_member_8_[Operophtera_brumata]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001047 F core promoter sequence-specific DNA binding
GO:0001946 P lymphangiogenesis
GO:0002040 P sprouting angiogenesis
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0008285 P negative regulation of cell population proliferation
GO:0030330 P DNA damage response, signal transduction by p53 class mediator
GO:0032466 P negative regulation of cytokinesis
GO:0032877 P positive regulation of DNA endoreduplication
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0060718 P chorionic trophoblast cell differentiation
GO:0070365 P hepatocyte differentiation
GO:0071930 P negative regulation of transcription involved in G1/S transition of mitotic cell cycle
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_TrvaFAMAMG_TR15408c0_g1_i1
Sequence
(Amino Acid)
MAVRVLIDTSNKNKTNLSPEQQDRQHKSKVRRLYDIANVFISIGLIEKVSGNLILKKPVF
KYVGPHKMKKSDKLMFTTPSPITLLSSLDSQIRTPFLQVYAGKSKRKLEFTTPSSNKEMK
LGITTPPHTPSHKWDEILLVADMELTRINKGASL
*(50 a.a.)

- SilkBase 1999-2023 -