SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG17927_internal:A_TrvaFAMAMG_TR15281c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
hypothetical_protein_KGM_13809_[Danaus_plexippus]
Ontology
GO:0000703 F oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity
GO:0002230 P positive regulation of defense response to virus by host
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003824 F catalytic activity
GO:0003906 F DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0006281 P DNA repair
GO:0006284 P base-excision repair
GO:0006285 P base-excision repair, AP site formation
GO:0006296 P nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006974 P cellular response to DNA damage stimulus
GO:0008152 P metabolic process
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0016829 F lyase activity
GO:0019104 F DNA N-glycosylase activity
GO:0046872 F metal ion binding
GO:0051536 F iron-sulfur cluster binding
GO:0051539 F 4 iron, 4 sulfur cluster binding
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:0098792 P xenophagy
RNA-seq EntryA_TrvaFAMAMG_TR15281c0_g1_i1
Sequence
(Amino Acid)
LLRFMYRSGFKQILKAIPAVMSKNQVKTVGTKKTSSAGKKPTQKEGKENDSEETSTKSVI
PDLNEFKFKKKPHIKVEFEKESPTKQQPEGLWEPPNWRDFLLNLRNMRANNDAPVDTMGC
HMNMDKNDPPEVTIRLSIPLSPILSCYLFLN
(49 a.a.)

- SilkBase 1999-2023 -