| Name | O_TrvaFAMAMG17747_complete:A_TrvaFAMAMG_TR14951c0_g1_i4 |
| Scaffold_id | |
NCBI non-redundant (nr) | PREDICTED:_BUB3-interacting_and_GLEBS_motif-containing_protein_ZNF207_isoform_X1_[Papilio_machaon] |
| Ontology |
| GO:0000070 |
P |
mitotic sister chromatid segregation |
| GO:0000775 |
C |
chromosome, centromeric region |
| GO:0000776 |
C |
kinetochore |
| GO:0000777 |
C |
kinetochore |
| GO:0001578 |
P |
microtubule bundle formation |
| GO:0005634 |
C |
nucleus |
| GO:0005694 |
C |
chromosome |
| GO:0005730 |
C |
nucleolus |
| GO:0005737 |
C |
cytoplasm |
| GO:0005819 |
C |
spindle |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005874 |
C |
microtubule |
| GO:0007049 |
P |
cell cycle |
| GO:0007059 |
P |
chromosome segregation |
| GO:0007067 |
P |
mitotic cell cycle |
| GO:0007094 |
P |
mitotic spindle assembly checkpoint signaling |
| GO:0008017 |
F |
microtubule binding |
| GO:0008201 |
F |
heparin binding |
| GO:0008608 |
P |
attachment of spindle microtubules to kinetochore |
| GO:0044822 |
F |
RNA binding |
| GO:0046785 |
P |
microtubule polymerization |
| GO:0046872 |
F |
metal ion binding |
| GO:0050821 |
P |
protein stabilization |
| GO:0051301 |
P |
cell division |
| GO:0051983 |
P |
regulation of chromosome segregation |
| GO:0090307 |
P |
mitotic spindle assembly |
| GO:1990047 |
C |
spindle matrix |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR14951c0_g1_i4 |
Sequence (Amino Acid) | MGPVPPGMYPGHMAMNHMMPPFMQAPRMMMAGMRPLFPAASAPTSTPSKPTFPAYSNATI
SAPPTTTPSSSADLKENGDVKPPPANSCPLVTATGTGSKIIHPPEDVSLEEIRARLHKYR
PVPRPAASPVVPPAVSHAEWSHLYATSLQSSMNNMNSLVYTSTANVAAHMSMAVAAAARQ
QAAAAAAMRRPVMGPGVMLGGVRVPVPVSVPVLPVVPQFSLVHRPLQPDLPRPAPT
*(78 a.a.) |