SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG17729_3prime_partial:A_TrvaFAMAMG_TR14947c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		heat_shock_protein_70-4_[Melitaea_cinxia]
Ontology
GO:0000166 F nucleotide binding
GO:0000795 C synaptonemal complex
GO:0001673 C male germ cell nucleus
GO:0001934 P positive regulation of protein phosphorylation
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0007140 P male meiotic nuclear division
GO:0007141 P male meiosis I
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0007286 P spermatid development
GO:0009408 P response to heat
GO:0009409 P response to cold
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0019899 F enzyme binding
GO:0030154 P cell differentiation
GO:0031662 P positive regulation of G2/M transition of mitotic cell cycle
GO:0032781 P positive regulation of ATP-dependent activity
GO:0036128 C CatSper complex
GO:0042026 P protein refolding
GO:0043209 C myelin sheath
GO:0051082 F unfolded protein binding
GO:0051861 F glycolipid binding
GO:0070062 C extracellular exosome
GO:0070194 P synaptonemal complex disassembly
GO:0072562 C blood microparticle
GO:0072687 C meiotic spindle
GO:0090084 P negative regulation of inclusion body assembly
GO:1901896 P positive regulation of ATPase-coupled calcium transmembrane transporter activity
RNA-seq EntryA_TrvaFAMAMG_TR14947c0_g1_i1
Sequence
(Amino Acid)
MVPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFNDSERLIGDAAKNQVAMN
PKNTVFDAKRLIGRKFNDATVQQDIKHWPFQVISEGGKPKIVVEYKGEKKKFAPEEISSM
VLTKMKEIAETFLGGVVKDAVITVPAYFNDSQRQATKDAGVIAAL
(54 a.a.)

- SilkBase 1999-2023 -