SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG1751_3prime_partial:A_TrvaFAMAMG_TR2952c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ATP-dependent_DNA_helicase_Q4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000405 F bubble DNA binding
GO:0000733 P obsolete DNA strand renaturation
GO:0001501 P skeletal system development
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006260 P DNA replication
GO:0006284 P base-excision repair
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0008026 F helicase activity
GO:0008270 F zinc ion binding
GO:0008284 P positive regulation of cell population proliferation
GO:0009378 F four-way junction helicase activity
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0032508 P DNA duplex unwinding
GO:0036310 F ATP-dependent DNA/DNA annealing activity
GO:0043140 F 3'-5' DNA helicase activity
GO:0043473 P pigmentation
GO:0045875 P negative regulation of sister chromatid cohesion
GO:0046872 F metal ion binding
GO:0048705 P skeletal system morphogenesis
RNA-seq EntryA_TrvaFAMAMG_TR2952c0_g1_i1
Sequence
(Amino Acid)
MEIIETIKKDKAYLKCKFVVKKWEKSFKLLHSRTPSKFDIKEAPPEIKYAYKKYFQLKSS
ALENSLSICDFDDENSSFKESSDGDKNDYALENTHCPLENTMPEFPSGDQMEKMLSMFLV
(39 a.a.)

- SilkBase 1999-2023 -