SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG17310_complete:A_TrvaFAMAMG_TR14230c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		14-3-3_epsilon_protein_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005875 C microtubule associated complex
GO:0005886 C plasma membrane
GO:0007088 P regulation of mitotic nuclear division
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007265 P Ras protein signal transduction
GO:0007280 P pole cell migration
GO:0007294 P germarium-derived oocyte fate determination
GO:0007411 P axon guidance
GO:0007444 P imaginal disc development
GO:0008103 P oocyte microtubule cytoskeleton polarization
GO:0008340 P determination of adult lifespan
GO:0008426 F protein kinase C inhibitor activity
GO:0009314 P response to radiation
GO:0009411 P response to UV
GO:0019904 F protein domain specific binding
GO:0040008 P regulation of growth
GO:0045172 C germline ring canal
GO:0045927 P positive regulation of growth
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0046982 F protein heterodimerization activity
GO:0048190 P wing disc dorsal/ventral pattern formation
GO:0050815 F phosphoserine residue binding
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071901 P negative regulation of protein serine/threonine kinase activity
RNA-seq EntryA_TrvaFAMAMG_TR14230c0_g1_i1
Sequence
(Amino Acid)
MSEREDNVYKAKLAEQAERYDEMVEAMKNVASRNVSDNELTVEERNLLSVAYKNVIGARR
ASWRIISSIEQKEETKGAEDKLNMIRAYRSQVEKELRDICSDILGVLDKYLIPSSQTGES
KVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNF
SVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQG
DGEAADADAKEPAHDADDQDVS
*(86 a.a.)

- SilkBase 1999-2023 -