| Name | O_TrvaFAMAMG17299_internal:A_TrvaFAMAMG_TR14182c0_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_LOW_QUALITY_PROTEIN:_notch-like_protein_isoform_X1_[Bombyx_mori] |
| Ontology |
| GO:0001501 |
P |
skeletal system development |
| GO:0001527 |
C |
microfibril |
| GO:0005178 |
F |
integrin binding |
| GO:0005201 |
F |
extracellular matrix structural constituent |
| GO:0005509 |
F |
calcium ion binding |
| GO:0005515 |
F |
protein binding |
| GO:0005576 |
C |
extracellular region |
| GO:0005578 |
C |
extracellular matrix |
| GO:0005604 |
C |
basement membrane |
| GO:0005615 |
C |
extracellular space |
| GO:0007507 |
P |
heart development |
| GO:0009653 |
P |
anatomical structure morphogenesis |
| GO:0031012 |
C |
extracellular matrix |
| GO:0032403 |
F |
protein-containing complex binding |
| GO:0035582 |
P |
sequestering of BMP in extracellular matrix |
| GO:0035583 |
P |
sequestering of TGFbeta in extracellular matrix |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR14182c0_g1_i1 |
Sequence
(Amino Acid) | NPFFIGNPDLLCMPPVAPPACEPDCGSNAHCVYGKNNICKCNKGFTGNPYKKCLSRKSIT
CASASCGRNAVCQQTKSSVECLCPPGYVGNPNIECKDIDECSTNPCGENALCINK
(37 a.a.) |
