SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG17230_internal:A_TrvaFAMAMG_TR14118c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC101742598_isoform_X1_[Bombyx_mori]
Ontology
GO:0000118 C histone deacetylase complex
GO:0001701 P in utero embryonic development
GO:0001780 P neutrophil homeostasis
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006915 P apoptotic process
GO:0006954 P inflammatory response
GO:0007275 P multicellular organism development
GO:0009617 P response to bacterium
GO:0009791 P post-embryonic development
GO:0016235 C aggresome
GO:0016607 C nuclear speck
GO:0030154 P cell differentiation
GO:0030900 P forebrain development
GO:0035115 P embryonic forelimb morphogenesis
GO:0035116 P embryonic hindlimb morphogenesis
GO:0042127 P regulation of cell population proliferation
GO:0042803 F protein homodimerization activity
GO:0043069 P negative regulation of programmed cell death
GO:0043231 C intracellular membrane-bounded organelle
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046329 P negative regulation of JNK cascade
GO:0046872 F metal ion binding
GO:0051726 P regulation of cell cycle
GO:0060039 P pericardium development
GO:0071425 P hematopoietic stem cell proliferation
GO:0072001 P renal system development
GO:0090336 P positive regulation of brown fat cell differentiation
GO:0098727 P maintenance of cell number
RNA-seq EntryA_TrvaFAMAMG_TR14118c0_g2_i1
Sequence
(Amino Acid)
DVPREKTKANKARSRCDTEYEEIEIAPHKSTADNDEICWPCNECDSTFPLQQLFELHKMT
KHRPKTEACNECNAKFFNKYDLAVHQLRHSTDMLFECIVCDKKFKRQILLKRHEKLMHAD
LLQQTCPSCPATFLSIEELEQHQLKHTNAPARNSVCAICEKRYLIYLKKNCHKAF
(57 a.a.)

- SilkBase 1999-2023 -