SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG17083_complete:A_TrvaFAMAMG_TR13725c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_fasciclin-2-like_isoform_X3_[Bombyx_mori]
Ontology
GO:0001746 P Bolwig's organ morphogenesis
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007413 P axonal fasciculation
GO:0007528 P neuromuscular junction development
GO:0007611 P learning or memory
GO:0007612 P learning
GO:0007614 P short-term memory
GO:0008038 P neuron recognition
GO:0008045 P motor neuron axon guidance
GO:0008355 P olfactory learning
GO:0008360 P regulation of cell shape
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016319 P mushroom body development
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0031225 C anchored component of membrane
GO:0031594 C neuromuscular junction
GO:0035152 P regulation of tube architecture, open tracheal system
GO:0035158 P regulation of tube diameter, open tracheal system
GO:0035159 P regulation of tube length, open tracheal system
GO:0036062 C presynaptic periactive zone
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0042734 C presynaptic membrane
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0045211 C postsynaptic membrane
GO:0048149 P behavioral response to ethanol
GO:0048667 P cell morphogenesis involved in neuron differentiation
GO:0048786 C presynaptic active zone
GO:0048803 P imaginal disc-derived male genitalia morphogenesis
GO:0050803 P regulation of synapse structure or activity
GO:0050808 P synapse organization
GO:0061174 C type I terminal bouton
GO:0072499 P photoreceptor cell axon guidance
GO:0072553 P terminal button organization
GO:0097482 C muscle cell postsynaptic specialization
GO:1904800 P negative regulation of neuron remodeling
RNA-seq EntryA_TrvaFAMAMG_TR13725c0_g1_i1
Sequence
(Amino Acid)
MLLVQFISTGVERSGFAQSQLLSSGAIIGLSLAGVIICLLIVDLLLFCFRRQGVIATLCG
KRAKKHNDEEAKLGRDEKEPLKDTDDAMKRNSSVEFDGHRVYATSGGPIIGKNSAV
*(38 a.a.)

- SilkBase 1999-2023 -