SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG16960_5prime_partial:A_TrvaFAMAMG_TR13679c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_heart-_and_neural_crest_derivatives-expressed_protein_2_isoform_X2_[Bombyx_mori]
Ontology
GO:0003007 P heart morphogenesis
GO:0003142 P cardiogenic plate morphogenesis
GO:0003144 P embryonic heart tube formation
GO:0003342 P proepicardium development
GO:0003357 P noradrenergic neuron differentiation
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0010002 P cardioblast differentiation
GO:0030859 P polarized epithelial cell differentiation
GO:0030878 P thyroid gland development
GO:0035051 P cardiocyte differentiation
GO:0035118 P embryonic pectoral fin morphogenesis
GO:0046983 F protein dimerization activity
GO:0048485 P sympathetic nervous system development
GO:0048703 P embryonic viscerocranium morphogenesis
GO:0055007 P cardiac muscle cell differentiation
GO:0060047 P heart contraction
GO:0071908 P determination of intestine left/right asymmetry
RNA-seq EntryA_TrvaFAMAMG_TR13679c1_g1_i1
Sequence
(Amino Acid)
EPYDPFHHNIHHSYTQNSAGLDCDLQSLPLRYDRPAPPSFIRVAKRRTTANKKERRRTQS
INTAFSDLRECIPNVPPDTKLSKIKTLRLATSYISYLLKVLESDGEPAGGFRADLHHTPP
RRRNAESSQSAADKRGKGRTGWPQHVWALELKTEQNLPT
*(52 a.a.)

- SilkBase 1999-2023 -