SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG16817_complete:A_TrvaFAMAMG_TR13640c0_g1_i6
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_discoidin_domain-containing_receptor_2-like_isoform_X1_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0001503 P ossification
GO:0003416 P endochondral bone growth
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005518 F collagen binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005925 C focal adhesion
GO:0006468 P protein phosphorylation
GO:0007155 P cell adhesion
GO:0007165 P signal transduction
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0008284 P positive regulation of cell population proliferation
GO:0010715 P regulation of extracellular matrix disassembly
GO:0010763 P positive regulation of fibroblast migration
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0030198 P extracellular matrix organization
GO:0030199 P collagen fibril organization
GO:0030500 P regulation of bone mineralization
GO:0031214 P biomineral tissue development
GO:0035988 P chondrocyte proliferation
GO:0038062 F protein tyrosine kinase collagen receptor activity
GO:0038063 P collagen-activated tyrosine kinase receptor signaling pathway
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045860 P positive regulation of protein kinase activity
GO:0046777 P protein autophosphorylation
GO:0048146 P positive regulation of fibroblast proliferation
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0070062 C extracellular exosome
GO:0090091 P positive regulation of extracellular matrix disassembly
RNA-seq EntryA_TrvaFAMAMG_TR13640c0_g1_i6
Sequence
(Amino Acid)
MMDLKRRLETTNVVEFPRHRLRMISKLAEGAFGTVYVAEADGVPEYNGTITSEKRLVAVK
FLCHDATLKERYIMEEFERDVRILAALSSPYLARVLGACRSPPLAVVLEYLELGDLCAFL
RTAVPPSSTTLLHIATQIAAGMQYLESLNFVHRDLAARNILIGKGYQVKISDFGTDNESY
TCDYYKVDGRIPLPLRWAAWESVLRGKYTTKSDVWAFAVTLYEIYSLCRRRPYEHLTDCE
VLENLSHLQADDGMFECIDRAPGCPRDIYELTLECWRRDELDRPTFGEIHLFLQRKSLSY
ATT
*(100 a.a.)

- SilkBase 1999-2023 -