SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG16314_5prime_partial:A_TrvaFAMAMG_TR13547c0_g1_i4
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_ATP-binding_cassette_sub-family_A_member_1-like_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0002790 P peptide secretion
GO:0005102 F signaling receptor binding
GO:0005215 F transporter activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005548 F phospholipid transporter activity
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006497 P protein lipidation
GO:0006810 P transport
GO:0006911 P phagocytosis, engulfment
GO:0007040 P lysosome organization
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007584 P response to nutrient
GO:0008203 P cholesterol metabolic process
GO:0008509 F anion transmembrane transporter activity
GO:0009897 C external side of plasma membrane
GO:0009986 C cell surface
GO:0010875 P positive regulation of cholesterol efflux
GO:0015914 P phospholipid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016197 P endosomal transport
GO:0016887 F ATP hydrolysis activity
GO:0017127 F cholesterol transfer activity
GO:0019905 F syntaxin binding
GO:0030139 C endocytic vesicle
GO:0030301 P cholesterol transport
GO:0030819 P obsolete positive regulation of cAMP biosynthetic process
GO:0031267 F small GTPase binding
GO:0032367 P intracellular cholesterol transport
GO:0032489 P regulation of Cdc42 protein signal transduction
GO:0033344 P cholesterol efflux
GO:0033700 P phospholipid efflux
GO:0034185 F apolipoprotein binding
GO:0034186 F apolipoprotein A-I binding
GO:0034188 F apolipoprotein A-I receptor activity
GO:0034364 C high-density lipoprotein particle
GO:0034380 P high-density lipoprotein particle assembly
GO:0034616 P response to laminar fluid shear stress
GO:0038027 P apolipoprotein A-I-mediated signaling pathway
GO:0042157 P lipoprotein metabolic process
GO:0042158 P lipoprotein biosynthetic process
GO:0042493 P response to xenobiotic stimulus
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042632 P cholesterol homeostasis
GO:0043231 C intracellular membrane-bounded organelle
GO:0043691 P reverse cholesterol transport
GO:0045121 C membrane raft
GO:0045332 P phospholipid translocation
GO:0045335 C phagocytic vesicle
GO:0048471 C perinuclear region of cytoplasm
GO:0050702 P interleukin-1 beta production
GO:0051117 F ATPase binding
GO:0055085 P transmembrane transport
GO:0055091 P phospholipid homeostasis
GO:0055098 P cellular response to low-density lipoprotein particle stimulus
GO:0055099 P cellular response to high density lipoprotein particle stimulus
GO:0060155 P platelet dense granule organization
GO:0071222 P cellular response to lipopolysaccharide
GO:0071300 P cellular response to retinoic acid
GO:0071397 P cellular response to cholesterol
GO:0098656 P anion transmembrane transport
RNA-seq EntryA_TrvaFAMAMG_TR13547c0_g1_i4
Sequence
(Amino Acid)
DLSNLAHTRIRRLLSADRNRVHFAAAVIGAPPIVILDECTAYQKFFVQRAMYSILYALKK
KGHSILISSSIVETHLPMTNRLFFIIDGTTYDVGTVDEFVDRYSAKGYTVVVHLKDDVDV
ERMFRNHFENFVVNDTSEVGILQALN
*(48 a.a.)

- SilkBase 1999-2023 -