SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG16178_5prime_partial:A_TrvaFAMAMG_TR13404c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_fibrinogen_C_domain-containing_protein_1-B-like_[Bombyx_mori]
Ontology
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0007155 P cell adhesion
GO:0007158 P neuron cell-cell adhesion
GO:0007411 P axon guidance
GO:0008306 P associative learning
GO:0009986 C cell surface
GO:0010977 P negative regulation of neuron projection development
GO:0022029 P telencephalon cell migration
GO:0022408 P negative regulation of cell-cell adhesion
GO:0030198 P extracellular matrix organization
GO:0030517 P negative regulation of axon extension
GO:0035641 P locomotory exploration behavior
GO:0045121 C membrane raft
GO:0048692 P negative regulation of axon extension involved in regeneration
GO:0050767 P regulation of neurogenesis
GO:0050804 P modulation of chemical synaptic transmission
GO:0050805 P negative regulation of synaptic transmission
GO:0050808 P synapse organization
GO:0050885 P neuromuscular process controlling balance
GO:0051968 P positive regulation of synaptic transmission, glutamatergic
GO:0051971 P positive regulation of transmission of nerve impulse
GO:0060291 P long-term synaptic potentiation
GO:0072534 C perineuronal net
RNA-seq EntryA_TrvaFAMAMG_TR13404c0_g1_i1
Sequence
(Amino Acid)
STLGNYYGTAGDSLSYHAGQKFSTYDMDNDEWKDGSCAQEHGGAWWYKECDKSNLNGKYS
TTTEENKGQTIYWISFKVPNYPLSKTKMMIRPLPARRPTDFNNNSRKILDGTKKESLYRE
TDPVEGFEE
*(42 a.a.)

- SilkBase 1999-2023 -