SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG15708_3prime_partial:A_TrvaFAMAMG_TR12658c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_chaoptin-like_[Amyelois_transitella]
Ontology
GO:0001875 F lipopolysaccharide immune receptor activity
GO:0002376 P immune system process
GO:0002755 P MyD88-dependent toll-like receptor signaling pathway
GO:0004888 F transmembrane signaling receptor activity
GO:0005886 C plasma membrane
GO:0006954 P inflammatory response
GO:0007165 P signal transduction
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0031663 P lipopolysaccharide-mediated signaling pathway
GO:0032497 P detection of lipopolysaccharide
GO:0034142 P toll-like receptor 4 signaling pathway
GO:0042116 P macrophage activation
GO:0045087 P innate immune response
GO:0046696 C lipopolysaccharide receptor complex
GO:0050702 P interleukin-1 beta production
GO:0050707 P regulation of cytokine production
GO:0050829 P defense response to Gram-negative bacterium
GO:1900227 P positive regulation of NLRP3 inflammasome complex assembly
RNA-seq EntryA_TrvaFAMAMG_TR12658c0_g2_i1
Sequence
(Amino Acid)
MVLGDGSARWALQVAALVACLLVGTLAPEKLEPCTGSPLCSCRTAHMSCIAVPLHRFPEW
PRIELQHLDVSMSNLEVIPESALDGLKLQTLVLVANKLHHIEQHAFSSMATTLASLYLGY
(39 a.a.)

- SilkBase 1999-2023 -