| Name | O_TrvaFAMAMG15478_complete:A_TrvaFAMAMG_TR12222c0_g2_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_DNA-directed_RNA_polymerase_III_subunit_RPC10_[Amyelois_transitella] |
| Ontology |
| GO:0001056 |
F |
RNA polymerase III activity |
| GO:0002376 |
P |
immune system process |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003677 |
F |
DNA binding |
| GO:0003899 |
F |
DNA-directed 5'-3' RNA polymerase activity |
| GO:0005634 |
C |
nucleus |
| GO:0005666 |
C |
RNA polymerase III complex |
| GO:0005730 |
C |
nucleolus |
| GO:0006351 |
P |
transcription, DNA-templated |
| GO:0006386 |
P |
termination of RNA polymerase III transcription |
| GO:0008270 |
F |
zinc ion binding |
| GO:0045087 |
P |
innate immune response |
| GO:0046872 |
F |
metal ion binding |
| GO:0051607 |
P |
defense response to virus |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR12222c0_g2_i1 |
Sequence
(Amino Acid) | MLFCPTCANMLMVEEGPEAALRYACNTCPYVYNIKKKVSSRTFPKLKELDYIMGGAAAWE
NVDSTDAVCPKCGHGRAYFMQLQTRSADEPMTTFYRCCNHKCAHNWRD
*(35 a.a.) |
