SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG15475_complete:A_TrvaFAMAMG_TR12222c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		hypothetical_protein_KGM_15428_[Danaus_plexippus]
Ontology
GO:0001541 P ovarian follicle development
GO:0004252 F serine-type endopeptidase activity
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0006465 P signal peptide processing
GO:0006508 P proteolysis
GO:0006627 P protein processing involved in protein targeting to mitochondrion
GO:0006801 P superoxide metabolic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007283 P spermatogenesis
GO:0007420 P brain development
GO:0008015 P blood circulation
GO:0008233 F peptidase activity
GO:0008236 F serine-type peptidase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0022904 P respiratory electron transport chain
GO:0030728 P ovulation
GO:0033108 P mitochondrial respiratory chain complex assembly
GO:0042720 C mitochondrial inner membrane peptidase complex
GO:0061300 P cerebellum vasculature development
RNA-seq EntryA_TrvaFAMAMG_TR12222c0_g1_i1
Sequence
(Amino Acid)
MWLKSVCKSVVFGVPIGVTFLDTVGYVARVEGISMQPVLNPESQNTDYVFLSRWAVRDYH
VNRGDVISLMSPKDPNQKIIKRVVALQGDVVSTLGYKNQYVKVPEGHCWVEGDHTGHTLD
SNTFGPVSLGLVNARAVCIVWPPSRWQSLEAKLPDNRNPISTAI
*(54 a.a.)

- SilkBase 1999-2023 -