SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG15389_complete:A_TrvaFAMAMG_TR12171c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
erythrocyte_carbonic_anhydrase_[Bombyx_mori]
Ontology
GO:0001822 P kidney development
GO:0002009 P morphogenesis of an epithelium
GO:0004064 F arylesterase activity
GO:0004089 F carbonate dehydratase activity
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005902 C microvillus
GO:0006730 P one-carbon metabolic process
GO:0006885 P regulation of pH
GO:0008270 F zinc ion binding
GO:0009268 P response to pH
GO:0010033 P response to organic substance
GO:0010043 P response to zinc ion
GO:0015670 P carbon dioxide transport
GO:0016020 C membrane
GO:0016323 C basolateral plasma membrane
GO:0016829 F lyase activity
GO:0030424 C axon
GO:0032230 P positive regulation of synaptic transmission, GABAergic
GO:0032849 P positive regulation of cellular pH reduction
GO:0038166 P angiotensin-activated signaling pathway
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0043209 C myelin sheath
GO:0043627 P response to estrogen
GO:0044070 P regulation of anion transport
GO:0045177 C apical part of cell
GO:0045672 P positive regulation of osteoclast differentiation
GO:0045780 P positive regulation of bone resorption
GO:0046872 F metal ion binding
GO:0046903 P secretion
GO:0048545 P response to steroid hormone
GO:0051453 P regulation of intracellular pH
GO:0070062 C extracellular exosome
GO:0071498 P cellular response to fluid shear stress
GO:2001150 P positive regulation of dipeptide transmembrane transport
GO:2001225 P regulation of chloride transport
RNA-seq EntryA_TrvaFAMAMG_TR12171c0_g1_i1
Sequence
(Amino Acid)
MADNEWGYTCENGPATWIEKFPQARGARQSPVDIPTSLVNSGSSLPALKWQYSVNHPRSI
VNPGYCWRVDENGYDSVLKGGPLHNDVYKLQQWHCHWGALNGEGSEHTVDGRSFSGELHL
VHWNTSKYHSFGEAAGKPDGLAVLGVFLMVGSKHDELDKVVRLLPFVQHKGDKVTFSEPL
DPAKLLPAKTAYWTYPGSLTTPPCTESVTWLLFKEPVQVSAEQLSLMRKLKCGEASHGVE
AMELLHNYRPTLPLGNRELREYGGN
*(87 a.a.)

- SilkBase 1999-2023 -