SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG1530_3prime_partial:A_TrvaFAMAMG_TR2321c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		putative_histone_deacetylase_8-like_protein_[Danaus_plexippus]
Ontology
GO:0000118 C histone deacetylase complex
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000228 C nuclear chromosome
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006333 P chromatin assembly or disassembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007062 P sister chromatid cohesion
GO:0008134 F transcription factor binding
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0016787 F hydrolase activity
GO:0030544 F Hsp70 protein binding
GO:0031397 P negative regulation of protein ubiquitination
GO:0031647 P regulation of protein stability
GO:0032041 F NAD-dependent histone deacetylase activity (H3-K14 specific)
GO:0032204 P regulation of telomere maintenance
GO:0046872 F metal ion binding
GO:0051879 F Hsp90 protein binding
GO:0070932 P histone H3 deacetylation
GO:0071922 P regulation of cohesin loading
RNA-seq EntryA_TrvaFAMAMG_TR2321c0_g1_i1
Sequence
(Amino Acid)
MYKMRVAYVWDEQLIEECIRLPAVVGRAHLVHNLIEAYNLIKKMKIVRSSLASYEDLKCF
HSEPYLEQLKKMQDVEDDYMTSEQDELYGIGYDCPPVSNMFKMVSTIAGGSITAAKCLTM
DVADVVINWCGGWHHAHKNGAEGFCYINDIVIAIEKLKNKFKKVLYIDLDVHHGNGVQDA
Y
(59 a.a.)

- SilkBase 1999-2023 -