SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG15289_internal:A_TrvaFAMAMG_TR12061c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_SLIT-ROBO_Rho_GTPase-activating_protein_3-like,_partial_[Bombyx_mori]
Ontology
GO:0003363 P lamellipodium assembly involved in ameboidal cell migration
GO:0005096 F GTPase activator activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005743 C mitochondrial inner membrane
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0007399 P nervous system development
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0021816 P extension of a leading process involved in cell motility in cerebral cortex radial glia guided migration
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030336 P negative regulation of cell migration
GO:0031410 C cytoplasmic vesicle
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0043197 C dendritic spine
GO:0043547 P positive regulation of GTPase activity
GO:0044327 C dendritic spine head
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045335 C phagocytic vesicle
GO:0046847 P filopodium assembly
GO:0048365 F small GTPase binding
GO:0048812 P neuron projection morphogenesis
GO:0051014 P actin filament severing
GO:0060996 P dendritic spine development
GO:2001223 P negative regulation of neuron migration
RNA-seq EntryA_TrvaFAMAMG_TR12061c0_g1_i1
Sequence
(Amino Acid)
AAAPDDAEFCARAREALRGVARPALLVLRYLFAFLAQVAAHSEHNMMDAWNLAICLGPTL
LAAAPGDGPHQVTAQNLLNELVKRTIVHHRDVFPQDVAPHTLYDPFTESDPSEENKKESL
PSYGEEEEGEGDGEDEERGGAEGSLDEHDAPDDLSLYNDDDDDDVSDECENGDWSERDSV
EFQRSESAERRVSLTQPDAPSAGGSTRDANCSRLAESTPDLVLDLPSRAPPPATPPAAHP
(79 a.a.)

- SilkBase 1999-2023 -