SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG15284_internal:A_TrvaFAMAMG_TR12056c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_kinesin-like_protein_KLP2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000278 P mitotic cell cycle
GO:0000922 C spindle pole
GO:0001578 P microtubule bundle formation
GO:0003774 F cytoskeletal motor activity
GO:0003777 F microtubule motor activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005813 C centrosome
GO:0005818 C aster
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005873 C plus-end kinesin complex
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0007018 P microtubule-based movement
GO:0007030 P Golgi organization
GO:0007049 P cell cycle
GO:0007052 P mitotic spindle organization
GO:0007059 P chromosome segregation
GO:0007067 P mitotic cell cycle
GO:0007100 P mitotic centrosome separation
GO:0008017 F microtubule binding
GO:0008152 P metabolic process
GO:0008574 F plus-end-directed microtubule motor activity
GO:0009306 P protein secretion
GO:0022008 P neurogenesis
GO:0031535 P plus-end directed microtubule sliding
GO:0042998 P positive regulation of Golgi to plasma membrane protein transport
GO:0045169 C fusome
GO:0045478 P fusome organization
GO:0051289 P protein homotetramerization
GO:0051298 P centrosome duplication
GO:0051299 P centrosome separation
GO:0051301 P cell division
GO:0072686 C mitotic spindle
GO:0090307 P mitotic spindle assembly
GO:0097431 C mitotic spindle pole
GO:1990498 C mitotic spindle microtubule
RNA-seq EntryA_TrvaFAMAMG_TR12056c0_g1_i1
Sequence
(Amino Acid)
SHLASTIDTLIQLSLSHRLTHSATVQEMEREVFSLEGEVRDVIERQEDLERRCLDNEYRV
YAPTGKTPSRVVYRYPRALAATSPQQRILDRFRANRNITQECIVLDDESPDVETPEVPPP
KQTQPLL
(41 a.a.)

- SilkBase 1999-2023 -