SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG15280_internal:A_TrvaFAMAMG_TR12053c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Cytoplasmic_polyadenylation_element-binding_protein_1,_partial_[Operophtera_brumata]
Ontology
GO:0000166 F nucleotide binding
GO:0000900 F translation repressor activity, mRNA regulatory element binding
GO:0000932 C P-body
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006397 P mRNA processing
GO:0006417 P regulation of translation
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0030529 C ribonucleoprotein complex
GO:0032869 P cellular response to insulin stimulus
GO:0035925 F mRNA 3'-UTR AU-rich region binding
GO:0042995 C cell projection
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046872 F metal ion binding
GO:0071230 P cellular response to amino acid stimulus
GO:0071456 P cellular response to hypoxia
GO:2000766 P negative regulation of cytoplasmic translation
RNA-seq EntryA_TrvaFAMAMG_TR12053c1_g1_i1
Sequence
(Amino Acid)
AAALATVMDDLFQGVVYAGIDTDKNKYPIGSGRVTFDNVRSYVRAISAAYVEIRTEKFTK
KVQVDPYLEDSMCSICNLQQGPYFCREPTCFGYFCRSCWSWQHGSEQHK
(35 a.a.)

- SilkBase 1999-2023 -