SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG151_complete:A_TrvaFAMAMG_TR57c1_g3_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_sorting_nexin-32_isoform_X2_[Papilio_machaon]
Ontology
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006897 P endocytosis
GO:0007175 P negative regulation of epidermal growth factor-activated receptor activity
GO:0008289 F lipid binding
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0016050 P vesicle organization
GO:0016241 P regulation of macroautophagy
GO:0019898 C extrinsic component of membrane
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030904 C retromer complex
GO:0030905 C retromer, tubulation complex
GO:0031410 C cytoplasmic vesicle
GO:0031901 C early endosome membrane
GO:0034452 F dynactin binding
GO:0035091 F phosphatidylinositol binding
GO:0042147 P retrograde transport, endosome to Golgi
GO:0042803 F protein homodimerization activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046982 F protein heterodimerization activity
GO:0097422 C tubular endosome
GO:1903593 P regulation of histamine secretion by mast cell
RNA-seq EntryA_TrvaFAMAMG_TR57c1_g3_i1
Sequence
(Amino Acid)
MMDCVEDSSNDPLSSVPISGPSPATIDPKVEKKKPSENVSLADNSLLVDISDALSEKEKV
KFTVHTKTTLPEFQKAEFIVVRQHEEFVWLHDRYEENEEYAGYIIPPAPPRPDFDASREK
LQRLGEGEGALTREEFLKMKEELEDEYLATFKKTVAMHEVFLQRLAAHPVFRRDSHLRVF
LEYEQDLCAKPRGKMDLIGGLVRSMTTTTDEIYLGATVRDVNDFF
*(74 a.a.)

- SilkBase 1999-2023 -