SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG15076_complete:A_TrvaFAMAMG_TR11969c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_DNA_ligase_4-like_[Bombyx_mori]
Ontology
GO:0000012 P single strand break repair
GO:0000166 F nucleotide binding
GO:0000793 C condensed chromosome
GO:0001701 P in utero embryonic development
GO:0002328 P pro-B cell differentiation
GO:0003677 F DNA binding
GO:0003909 F DNA ligase activity
GO:0003910 F DNA ligase (ATP) activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0005958 C DNA-dependent protein kinase-DNA ligase 4 complex
GO:0006260 P DNA replication
GO:0006266 P DNA ligation
GO:0006273 P lagging strand elongation
GO:0006281 P DNA repair
GO:0006297 P nucleotide-excision repair, DNA gap filling
GO:0006302 P double-strand break repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007417 P central nervous system development
GO:0008022 F protein C-terminus binding
GO:0008283 P cell population proliferation
GO:0010165 P response to X-ray
GO:0010212 P response to ionizing radiation
GO:0010332 P response to gamma radiation
GO:0016874 F ligase activity
GO:0032807 C DNA ligase IV complex
GO:0033077 P T cell differentiation in thymus
GO:0033151 P V(D)J recombination
GO:0033152 P immunoglobulin V(D)J recombination
GO:0033153 P T cell receptor V(D)J recombination
GO:0035019 P somatic stem cell population maintenance
GO:0043524 P negative regulation of neuron apoptotic process
GO:0045190 P isotype switching
GO:0046872 F metal ion binding
GO:0048146 P positive regulation of fibroblast proliferation
GO:0050769 P positive regulation of neurogenesis
GO:0051102 P DNA ligation involved in DNA recombination
GO:0051103 P DNA ligation involved in DNA repair
GO:0051276 P chromosome organization
GO:0051301 P cell division
GO:0051402 P neuron apoptotic process
GO:0070419 C nonhomologous end joining complex
GO:0071285 P cellular response to lithium ion
GO:0071897 P DNA biosynthetic process
GO:0097680 P double-strand break repair via classical nonhomologous end joining
GO:2001252 P positive regulation of chromosome organization
RNA-seq EntryA_TrvaFAMAMG_TR11969c1_g1_i1
Sequence
(Amino Acid)
MATESIKSVNAIKFNDLCKILDRMSGMKKKVDSYKVFLDYLTHLKIKIPKTADGKKPTMF
PLLRLLLPKLERERPAYNLKEKALGSLLISVLALSKKSPDAKRLLNFTSHSNNQMSDFAS
VACFVLKHKVGIDIEELTIGDINEALDKIATHAENRSK
*(52 a.a.)

- SilkBase 1999-2023 -